PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010555685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 335aa    MW: 36533.8 Da    PI: 8.9535
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010555685.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.43e-1276120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_010555685.1  76 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 120
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.06E-1670126IPR009057Homeodomain-like
PROSITE profilePS5129413.75871125IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-674126IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-1874123IPR006447Myb domain, plants
SMARTSM007179.6E-1075123IPR001005SANT/Myb domain
PfamPF002496.6E-1076120IPR001005SANT/Myb domain
CDDcd001671.47E-778121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVSRNPNPGD GFYLDPTGMT LPGLAPFSGG TVDATPSSSA VVAAASTATA TATATESSWE  60
DPSKKVRKPY TITKSRESWT EPEHDKFLEA LQLFDRDWKK IEAFIGSKTV IQIRSHAQKY  120
FLKVQKSGTG EHLPPPRPKR KAAHPYPQKA PKNAQPQASG SFKSSSAPSE PGYVFSHESS  180
SMMMNSGNFA GAPPWTNNVQ TISFSPLQQK GAVQTNNCSS SSENTPRTRP NRNTSEPGNH  240
GHSLRVLPDF AQVYSFIGSV FDPYATDHLQ KLKKMDPIDV ETVMLLMRNL SINLASPDFE  300
DHRQLLSCYD IGSETTDPGG GTSKTLNKEK PEIST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010555685.10.0PREDICTED: protein REVEILLE 6-like isoform X2
SwissprotQ8H0W31e-168RVE6_ARATH; Protein REVEILLE 6
TrEMBLR0GMQ91e-168R0GMQ9_9BRAS; Uncharacterized protein (Fragment)
STRINGAT5G52660.21e-165(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-141MYB_related family protein